Matrilin-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70634

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Matrilin-1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MATN1(matrilin 1, cartilage matrix protein) The peptide sequence was selected from the middle region of MATN1 (NP_002370). Peptide sequence KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Matrilin-1 Antibody - BSA Free

Western Blot: Matrilin-1 Antibody [NBP1-70634]

Western Blot: Matrilin-1 Antibody [NBP1-70634]

Western Blot: Matrilin-1 Antibody [NBP1-70634] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Matrilin-1 Antibody [NBP1-70634]

Western Blot: Matrilin-1 Antibody [NBP1-70634]

Western Blot: Matrilin-1 Antibody [NBP1-70634] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 12500 Positive control: OVCAR-3 cell lysate MATN1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.

Applications for Matrilin-1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Matrilin-1

This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene ha

Alternate Names

CMP, CRTM, MATN1, Matrilin1

Entrez Gene IDs

4146 (Human)

Gene Symbol

MATN1

UniProt

P21941 (Human)

Additional Matrilin-1 Products

Product Documents for Matrilin-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Matrilin-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Matrilin-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Matrilin-1 Antibody - BSA Free and earn rewards!

Have you used Matrilin-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies