MAX binding protein Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56563

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPA

Reactivity Notes

Mouse 89%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MAX binding protein Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MAX binding protein Antibody [NBP2-56563]

Immunocytochemistry/ Immunofluorescence: MAX binding protein Antibody [NBP2-56563]

Immunocytochemistry/Immunofluorescence: MAX binding protein Antibody [NBP2-56563] - Staining of human cell line HeLa shows localization to nucleoplasm.
MAX binding protein Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: MAX binding protein Antibody - BSA Free [NBP2-56563]

Chromatin Immunoprecipitation-exo-Seq: MAX binding protein Antibody - BSA Free [NBP2-56563]

ChIP-Exo-Seq composite graph for Anti-MNT (NBP2-56563) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for MAX binding protein Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAX binding protein

MNT, also known as MAX-binding protein MNT, is a 582 amino acid protein that is 62 kDa, has a basic-Helix-Loop-Helix-zipper domain (bHLHzip) with which it binds the canonical DNA sequence CANNTG, known as the E box, following heterodimerization with Max proteins. This protein is likely a transcriptional repressor and an antagonist of Myc-dependent transcriptional activation and cell growth and represses transcription by binding to DNA binding proteins at its N-terminal Sin3-interaction domain. Current research is being performed on several diseases and disorders including Miller-Dieker lissencephaly, Miller-Dieker syndrome, Williams-Beuren syndrome, tetanus neonatorum, rheumatic fever, lissencephaly, tetanus, cholestasis, rabies, medulloblastoma, lung cancer, neuroblastoma, and leukemia.

Alternate Names

BHLHD3, bHLHd3Max-interacting protein, Class D basic helix-loop-helix protein 3, MAD6, MAX binding protein, MXD6, Myc antagonist MNT, Protein ROX, ROXmax-binding protein MNT

Gene Symbol

MNT

Additional MAX binding protein Products

Product Documents for MAX binding protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAX binding protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAX binding protein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAX binding protein Antibody - BSA Free and earn rewards!

Have you used MAX binding protein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...