MAZ Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57338

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MAZ Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MAZ Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MAZ Antibody [NBP2-57338]

Immunocytochemistry/ Immunofluorescence: MAZ Antibody [NBP2-57338]

Immunocytochemistry/Immunofluorescence: MAZ Antibody [NBP2-57338] - Staining of human cell line MCF7 shows localization to nucleoplasm.
MAZ Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: MAZ Antibody - BSA Free [NBP2-57338]

Chromatin Immunoprecipitation-exo-Seq: MAZ Antibody - BSA Free [NBP2-57338]

ChIP-Exo-Seq composite graph for Anti-MAZ (NBP2-57338) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for MAZ Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAZ

MAZ (MYC-associated zinc finger protein), also known as SAF-1 (serum amyloid A activating factor 1, is a C2H2-type zinc finger protein. MAZ/SAF-1 was identified as a factor that associates with the c-myc P2 promoter. MAZ/SAF-1 has been shown to bind the promoter regions of several genes and function as a transcription factor in the inflammatory response. Alternate names for MAZ/SF-1 include purine-binding transcription factor, zinc-finger protein 87 kilodaltons, Pur-1, ZF87, and ZIF87.

Alternate Names

MAZI, myc-associated zinc finger protein, MYC-associated zinc finger protein (purine-binding transcription factor), PUR1, Pur-1SAF-2, Purine-binding transcription factor, serum amyloid A activating factor 1, serum amyloid A activating factor 2, Transcription factor Zif87, ZF87SAF-1, Zif87, Zinc finger protein 801, zinc-finger protein, 87 kilodaltons, ZNF801SAF-3

Gene Symbol

MAZ

Additional MAZ Products

Product Documents for MAZ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAZ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAZ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAZ Antibody - BSA Free and earn rewards!

Have you used MAZ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies