MBNL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79451

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MBNL2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human MBNL2The immunogen for this antibody is MBNL2. Peptide sequence ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MBNL2 Antibody - BSA Free

Western Blot: MBNL2 Antibody [NBP1-79451]

Western Blot: MBNL2 Antibody [NBP1-79451]

Western Blot: MBNL2 Antibody [NBP1-79451] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: MBNL2 Antibody [NBP1-79451]

Western Blot: MBNL2 Antibody [NBP1-79451]

Western Blot: MBNL2 Antibody [NBP1-79451] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: MBNL2 Antibody [NBP1-79451]

Western Blot: MBNL2 Antibody [NBP1-79451]

Western Blot: MBNL2 Antibody [NBP1-79451] - Hela, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that MBNL2 is expressed in HeLa.
Western Blot: MBNL2 Antibody [NBP1-79451]

Western Blot: MBNL2 Antibody [NBP1-79451]

Western Blot: MBNL2 Antibody [NBP1-79451] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Applications for MBNL2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MBNL2

MBNL2 encodes a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein. Drosophila muscleblind is a gene required for photoreceptor differentiation. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. [provided by RefSeq]

Alternate Names

DKFZp781H1296, MBLL39Muscleblind-like protein 1, MBLLMGC120628, MGC120625, MGC120626, MLP1, muscleblind-like 2 (Drosophila), muscleblind-like protein 2, Muscleblind-like protein-like, Muscleblind-like protein-like 39, PRO2032

Gene Symbol

MBNL2

Additional MBNL2 Products

Product Documents for MBNL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MBNL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MBNL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MBNL2 Antibody - BSA Free and earn rewards!

Have you used MBNL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies