MCT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85265

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MCT2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human MCT2. Peptide sequence: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MCT2 Antibody - BSA Free

Western Blot: MCT2 Antibody [NBP2-85265]

Western Blot: MCT2 Antibody [NBP2-85265]

Western Blot: MCT2 Antibody [NBP2-85265] - Host: Rabbit. Target Name: SLC16A7. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml
Western Blot: MCT2 Antibody [NBP2-85265]

Western Blot: MCT2 Antibody [NBP2-85265]

Western Blot: MCT2 Antibody [NBP2-85265] - Host: Rabbit. Target: SLC16A7. Positive control (+): Human Fetal Heart (HE). Negative control (-): Human Brain (BR). Antibody concentration: 1ug/ml

Applications for MCT2 Antibody - BSA Free

Application
Recommended Usage

Simple Western

1:50

Western Blot

1.0 ug/ml
Application Notes

See Simple Western Antibody Database for Simple Western validation: Tested in Mouse Eye Tissue from D2 and D2G ON mouse model, separated by Size, antibody dilution of 1:50

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCT2

Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family 16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. MCT2 is a high affinity transporter that catalyzes the rapid transport of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate across the plasma membrane.

Long Name

Monocarboxylate transporter 2

Alternate Names

MCT 2, SLC16A7

Gene Symbol

SLC16A7

Additional MCT2 Products

Product Documents for MCT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MCT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCT2 Antibody - BSA Free and earn rewards!

Have you used MCT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies