MDGA2 (MAM domain-containing glycosylphosphatidylinositol anchor protein 2; also named MAMDC1) is a 130 kDa member of the Ig superfamily of proteins. Human MDGA2 is synthesized as a 956 amino acid (aa) precursor that contains a 25 aa signal sequence, a 906 aa mature chain, and a 25 aa propeptide. The mature chain consists of six Ig-like domains, followed by a MAM domain (aa 746-921) and a GPI anchor. In addition, there are eight potential sites for N-linked glycosylation. Mature human MDGA2 shares 98% aa sequence identity with mature mouse and rat MDGA2. MDGA2 is structurally similar to other IgCAMS, such as the L1 family and axonin 1, which have roles in cell adhesion, migration, and process outgrowth. Northern blot analysis shows MDGA2 expression is limited to the central and peripheral nervous system. Within the brain, moderate expression is observed in the cerebral cortex, the hindbrain, the basilar pons, the neocortex, the hippocampus, the amygdala, olfactory bulb, and selected nuclei of the thalamus. The similarity of MDGA2 to other Ig-containing molecules, and its temporal-spatial patterns of expression within restricted neuronal populations, suggest a role for MDGA2 in regulating neuronal migration, as well as other aspects of neural development, including axon guidance. One study shows that MDGA2 gene is implicated in neuroticism.
MDGA2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-93532
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYAVKSLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MDGA2 Antibody - BSA Free
Immunohistochemistry-Paraffin: MDGA2 Antibody [NBP1-93532]
Immunohistochemistry-Paraffin: MDGA2 Antibody [NBP1-93532] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.Applications for MDGA2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MDGA2
Long Name
MAM Domain Containing Glycosylphosphatidylinositol Anchor 2
Alternate Names
MAMDC1
Gene Symbol
MDGA2
Additional MDGA2 Products
Product Documents for MDGA2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MDGA2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for MDGA2 Antibody - BSA Free
Customer Reviews for MDGA2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MDGA2 Antibody - BSA Free and earn rewards!
Have you used MDGA2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...