MDM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59376

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MDM1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MDM1(Mitochondrial deafness modifier 1) The peptide sequence was selected from the N terminal of MDM1. Peptide sequence GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MDM1 Antibody - BSA Free

Western Blot: MDM1 Antibody [NBP1-59376]

Western Blot: MDM1 Antibody [NBP1-59376]

Western Blot: MDM1 Antibody [NBP1-59376] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for MDM1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MDM1

MDM1 is a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. This gene encodes a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. In mouse several transcripts have been described for this gene which result from alternative polyadenylation, splicing and exon usage.

Alternate Names

FLJ95264, Mdm1 nuclear protein homolog (mouse), Mdm4, transformed 3T3 cell double minute 1, p53 binding protein, Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse), nuclear protein double minute 1, nuclear protein MDM1

Gene Symbol

MDM1

UniProt

B2RB22 (Human)

Additional MDM1 Products

Product Documents for MDM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MDM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MDM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MDM1 Antibody - BSA Free and earn rewards!

Have you used MDM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies