MGAT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62441

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all N-Acetylglucosaminyltransferase 2/MGAT2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MGAT2(mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase) The peptide sequence was selected from the middle region of MGAT2. Peptide sequence YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MGAT2 Antibody - BSA Free

Western Blot: MGAT2 Antibody [NBP1-62441]

Western Blot: MGAT2 Antibody [NBP1-62441]

Western Blot: MGAT2 Antibody [NBP1-62441] - 293T cells lysate, concentration 0.2-1 ug/ml.

Applications for MGAT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: N-Acetylglucosaminyltransferase 2/MGAT2

MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The coding region of this gene is intronless. Transcript variants with a spliced 5' UTR may exist, but their biological validity has not been determined.

Long Name

Mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase

Alternate Names

CDG2A, GlcNAc-T II, GNT2

Gene Symbol

MGAT2

UniProt

Q10469 (Human)

Additional N-Acetylglucosaminyltransferase 2/MGAT2 Products

Product Documents for MGAT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MGAT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glycobiology-related Enzymes

Customer Reviews for MGAT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MGAT2 Antibody - BSA Free and earn rewards!

Have you used MGAT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies