MGAT4A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04923

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all MGAT4A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 28-100 of human MGAT4A (NP_036346.1). QNGKEKLIAYQREFLALKERLRIAEHRISQRSSELNTIVQQFKRVGAETNGSKDALNKFSDNTLKLLKELTSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MGAT4A Antibody - Azide and BSA Free

Western Blot: MGAT4A AntibodyAzide and BSA Free [NBP3-04923]

Western Blot: MGAT4A AntibodyAzide and BSA Free [NBP3-04923]

Western Blot: MGAT4A Antibody [NBP3-04923] - Analysis of extracts of various cell lines, using MGAT4A antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Applications for MGAT4A Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:200-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MGAT4A

MGAT4A encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme B, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1,4 linkage to the Man-alpha-1,3-Man-beta-1,4-GlcNAc arm of R-Man-alpha-1,6(GlcNAc-beta-1,2-Man-alpha-1,3)Man-beta-1,4-GlcNAc-beta-1,4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation.

Long Name

alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A

Alternate Names

EC 2.4.1.145, GlcNAc-T IVa, GnT-4a, GNT-IV, GNT-IVA, N-Acetylglucosaminyltransferase IVa

Gene Symbol

MGAT4A

Additional MGAT4A Products

Product Documents for MGAT4A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MGAT4A Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

Glycobiology-related Enzymes

Customer Reviews for MGAT4A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MGAT4A Antibody - Azide and BSA Free and earn rewards!

Have you used MGAT4A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies