MICB Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56506

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MICB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MICB Antibody [NBP2-56506]

Immunocytochemistry/ Immunofluorescence: MICB Antibody [NBP2-56506]

Immunocytochemistry/Immunofluorescence: MICB Antibody [NBP2-56506] - Staining of human cell line SiHa shows localization to the Golgi apparatus & vesicles.
MICB Antibody - BSA Free

Western Blot: MICB Antibody - BSA Free [NBP2-56506] -

Pharmacologic inhibition of MUC1-C with GO-203 induces MICA/B expression. (A and B) RKO (A) and COLO 201 (B) cells treated with 5 μM GO-203 for 3 days were analyzed for MICA and MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1) (left). Lysates were immunoblotted with antibodies against the indicated proteins (right). (C) RKO cells expressing a tet-MUC1-C(AQA) vector and treated with vehicle or DOX for 7 days were analyzed for MUC1-C(AQA), MICA and MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1). (D and E) RKO (D) and COLO 201 (E) cells treated with 5 μM GO-203 for 3 days were analyzed for cell surface MICA (left) and MICB (right) expression by flow cytometry. (F) RKO cells treated with 5 μM GO-203 and/or 5 μM DEC for 5 days were analyzed for cell surface MICA and MICB expression by flow cytometry. The red profile depicts reactivity with the isotype control antibody. (G) RKO cells grown as tumorspheres (left) and treated with 5 μM GO-203 for 3 days were analyzed for cell surface MICA and MICB expression by flow cytometry (right). MICA, MHC class I chain-related polypeptide A; MICB, MHC class I chain-related polypeptide B. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36754452), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MICB Antibody - BSA Free

Western Blot: MICB Antibody - BSA Free [NBP2-56506] -

Pharmacologic inhibition of MUC1-C with GO-203 induces MICA/B expression. (A and B) RKO (A) and COLO 201 (B) cells treated with 5 μM GO-203 for 3 days were analyzed for MICA and MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1) (left). Lysates were immunoblotted with antibodies against the indicated proteins (right). (C) RKO cells expressing a tet-MUC1-C(AQA) vector and treated with vehicle or DOX for 7 days were analyzed for MUC1-C(AQA), MICA and MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1). (D and E) RKO (D) and COLO 201 (E) cells treated with 5 μM GO-203 for 3 days were analyzed for cell surface MICA (left) and MICB (right) expression by flow cytometry. (F) RKO cells treated with 5 μM GO-203 and/or 5 μM DEC for 5 days were analyzed for cell surface MICA and MICB expression by flow cytometry. The red profile depicts reactivity with the isotype control antibody. (G) RKO cells grown as tumorspheres (left) and treated with 5 μM GO-203 for 3 days were analyzed for cell surface MICA and MICB expression by flow cytometry (right). MICA, MHC class I chain-related polypeptide A; MICB, MHC class I chain-related polypeptide B. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36754452), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MICB Antibody - BSA Free

Western Blot: MICB Antibody - BSA Free [NBP2-56506] -

MUC1-C suppresses MICB expression. (A and B) RKO/tet-MUC1shRNA (A) and COLO 201/tet-MUC1shRNA (B) cells treated with vehicle or DOX for 7 days were analyzed for MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1) (left). Lysates were immunoblotted with antibodies against the indicated proteins (right). (C and D) RKO/tet-MUC1shRNA (C) and COLO 201/tet-MUC1shRNA (D) cells treated with vehicle or DOX for 7 days were analyzed for cell surface MICB expression by flow cytometry (left). Geometric MFI values for each histogram are indicated in the table (right). (E.) BT-549/tet-MUC1shRNA cells treated with vehicle or DOX for 7 days were analyzed for MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1) (left). Lysates were immunoblotted with antibodies against the indicated proteins (right). (F–H) BT-549/tet-MUC1shRNA (F), H1975/tet-MUC1shRNA (G) and DU145/tet-MUC1shRNA (H) cells treated with vehicle or DOX for 7 days were analyzed for cell surface MICB expression by flow cytometry. MICB, MHC class I chain-related polypeptide B. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36754452), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MICB Antibody - BSA Free

Western Blot: MICB Antibody - BSA Free [NBP2-56506] -

MUC1-C suppresses MICB expression. (A and B) RKO/tet-MUC1shRNA (A) and COLO 201/tet-MUC1shRNA (B) cells treated with vehicle or DOX for 7 days were analyzed for MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1) (left). Lysates were immunoblotted with antibodies against the indicated proteins (right). (C and D) RKO/tet-MUC1shRNA (C) and COLO 201/tet-MUC1shRNA (D) cells treated with vehicle or DOX for 7 days were analyzed for cell surface MICB expression by flow cytometry (left). Geometric MFI values for each histogram are indicated in the table (right). (E.) BT-549/tet-MUC1shRNA cells treated with vehicle or DOX for 7 days were analyzed for MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1) (left). Lysates were immunoblotted with antibodies against the indicated proteins (right). (F–H) BT-549/tet-MUC1shRNA (F), H1975/tet-MUC1shRNA (G) and DU145/tet-MUC1shRNA (H) cells treated with vehicle or DOX for 7 days were analyzed for cell surface MICB expression by flow cytometry. MICB, MHC class I chain-related polypeptide B. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36754452), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MICB Antibody - BSA Free

Western Blot: MICB Antibody - BSA Free [NBP2-56506] -

MUC1-C suppresses MICB expression. (A and B) RKO/tet-MUC1shRNA (A) and COLO 201/tet-MUC1shRNA (B) cells treated with vehicle or DOX for 7 days were analyzed for MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1) (left). Lysates were immunoblotted with antibodies against the indicated proteins (right). (C and D) RKO/tet-MUC1shRNA (C) and COLO 201/tet-MUC1shRNA (D) cells treated with vehicle or DOX for 7 days were analyzed for cell surface MICB expression by flow cytometry (left). Geometric MFI values for each histogram are indicated in the table (right). (E.) BT-549/tet-MUC1shRNA cells treated with vehicle or DOX for 7 days were analyzed for MICB mRNA levels by qRT-PCR (left). The results (mean+/-SD of four determinations) are expressed as relative mRNA levels compared with that obtained for vehicle-treated cells (assigned a value of 1) (left). Lysates were immunoblotted with antibodies against the indicated proteins (right). (F–H) BT-549/tet-MUC1shRNA (F), H1975/tet-MUC1shRNA (G) and DU145/tet-MUC1shRNA (H) cells treated with vehicle or DOX for 7 days were analyzed for cell surface MICB expression by flow cytometry. MICB, MHC class I chain-related polypeptide B. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36754452), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for MICB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MICB

MICB encodes a heavily glycosylated protein which is a ligand for the NKG2D type II receptor. Binding of the ligand activates the cytolytic response of natural killer (NK) cells, CD8 alphabeta T cells, and gammadelta T cells which express the receptor. This protein is stress-induced and is similar to MHC class I molecules; however, it does not associate with beta-2-microglobulin or bind peptides. [provided by RefSeq]

Long Name

MHC Class I-related Protein B

Alternate Names

MHC class I chain-related protein B, MHC class I mic-B antigen, MHC class I polypeptide-related sequence B, MIC-B, PERB11.2MHC class I-like molecule PERB11.2-IMX, stress inducible class I homolog

Gene Symbol

MICB

Additional MICB Products

Product Documents for MICB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MICB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for MICB Antibody - BSA Free

Customer Reviews for MICB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MICB Antibody - BSA Free and earn rewards!

Have you used MICB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...