MINDY4B/FAM188B2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-18693

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MINDY4B/FAM188B2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MINDY4B/FAM188B2 (LOC646951): SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MINDY4B/FAM188B2 Antibody - BSA Free

MINDY4B/FAM188B2 Antibody [NBP3-18693] - WB Suggested MINDY4B/FAM188B2 antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate

Applications for MINDY4B/FAM188B2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MINDY4B/FAM188B2

Predicted to enable Lys48-specific deubiquitinase activity. Predicted to be involved in protein K48-linked deubiquitination. [provided by Alliance of Genome Resources, Apr 2022]

Alternate Names

C3orf76, epididymis secretory sperm binding protein, FAM188B2, family with sequence similarity 188 member B2, inactive ubiquitin carboxyl-terminal hydrolase MINDY-4B, protein FAM188B2, Putative UPF0526 protein B

Gene Symbol

MINDY4B

Additional MINDY4B/FAM188B2 Products

Product Documents for MINDY4B/FAM188B2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MINDY4B/FAM188B2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MINDY4B/FAM188B2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MINDY4B/FAM188B2 Antibody - BSA Free and earn rewards!

Have you used MINDY4B/FAM188B2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies