MKP-1/DUSP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57354

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (96%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MKP-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MKP-1/DUSP1 Antibody - BSA Free

Western Blot: MKP-1/DUSP1 Antibody [NBP2-57354]

Western Blot: MKP-1/DUSP1 Antibody [NBP2-57354]

Western Blot: MKP-1/DUSP1 Antibody [NBP2-57354] - Analysis in human cell line U-2 OS.
Immunocytochemistry/ Immunofluorescence: MKP-1/DUSP1 Antibody [NBP2-57354]

Immunocytochemistry/ Immunofluorescence: MKP-1/DUSP1 Antibody [NBP2-57354]

Immunocytochemistry/Immunofluorescence: MKP-1/DUSP1 Antibody [NBP2-57354] - Staining of human cell line SiHa shows localization to nucleoli & cytosol. Antibody staining is shown in green.

Applications for MKP-1/DUSP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MKP-1

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation.

Long Name

MAP Kinase Phosphatase 1

Alternate Names

CL100, DUSP1, HVH1, MKP1, PTPN10

Gene Symbol

DUSP1

Additional MKP-1 Products

Product Documents for MKP-1/DUSP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MKP-1/DUSP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MKP-1/DUSP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MKP-1/DUSP1 Antibody - BSA Free and earn rewards!

Have you used MKP-1/DUSP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies