MMP-15/MT2-MMP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10016

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MMP-15/MT2-MMP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MMP-15/MT2-MMP (NP_002419.1). Peptide sequence DDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MMP-15/MT2-MMP Antibody - BSA Free

Western Blot: MMP-15/MT2-MMP Antibody [NBP3-10016]

Western Blot: MMP-15/MT2-MMP Antibody [NBP3-10016]

Western Blot: MMP-15/MT2-MMP Antibody [NBP3-10016] - Western blot analysis of MMP-15/MT2-MMP in Human DLD1 Whole Cell. Antibody dilution at 1.0ug/ml

Applications for MMP-15/MT2-MMP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMP-15/MT2-MMP

MMPs are a group of enzymes involved in matrix degradation. Of the sixteen members of matrix metalloproteinase family ten exist in soluble form whereas MT MMPs exist as integral membrane proteins. MT1 MMp, MT2 MMP and MT3 MMP also known as MMP 14, MMP 15 and MMP 16 respectively. They contain a C-terminal transmembrane domain anchoring them to the cell surface. MT2 MMP plays a minor role in activation of pro-MMP 2 to its active form in breast carcinomas. Coexpression of MT1 MMP and MT2 MMP in advanced stages of breast carcinomas is indicative of possible involvement of MT2 MMP in its metastasis.

Long Name

Matrix Metalloproteinase 15/Membrane Type 2 MMP

Alternate Names

MMP15, MT2-MMP

Gene Symbol

MMP15

Additional MMP-15/MT2-MMP Products

Product Documents for MMP-15/MT2-MMP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMP-15/MT2-MMP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for MMP-15/MT2-MMP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MMP-15/MT2-MMP Antibody - BSA Free and earn rewards!

Have you used MMP-15/MT2-MMP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies