MMRN1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-84014PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all MMRN1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMRN1.

Source: E. coli

Amino Acid Sequence: RHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLND

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84014.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-84014PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MMRN1

MMRN1, also known as Multimerin-1, has 2 isoforms, a 1,228 amino acid long isoform that is 138 kDa and a short 531 amino acid isoform that is 58 kDa; synthesized by endothelial cells and megakaryocytes: stored in platelet alpha granules and endothelial cell Weibel-Palade bodies; can be found in vascular tissues such as placenta, lung, and liver. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers; it is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V and as an extracellular matrix or adhesive protein. Studies on this protein have shown a relationship with the following diseases and disorders: bleeding disorder, quebec platelet disorder, neonatal alloimmune thrombocytopenia, von Willebrand's disease, polycythemia vera, myocardial infarction, atrial fibrillation, thrombocytopenia, polycythemia, vascular disease, diabetic retinopathy, thrombosis, periodontitis, periodontal disease, hepatitis b, Parkinson's disease, vaginitis, asthma, and colorectal cancer. The MMRN1 protein has also shown an interaction with CDKN2A, F5, APC, A2M, ALB, and 30 other proteins in hemostasis, platelet degranulation, platelet activation, signaling and aggregation, and response to elevated platelet cytosolic Ca2+ pathways.

Alternate Names

ECMmultimerin, Elastin microfibril interface located protein 4, Elastin microfibril interfacer 4, EMILIN-4, EMILIN4GPIa*, Endothelial cell multimerin, glycoprotein Ia*, GPIA*, MMRN, multimerin 1, multimerin-1

Gene Symbol

MMRN1

Additional MMRN1 Products

Product Documents for MMRN1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMRN1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for MMRN1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review MMRN1 Recombinant Protein Antigen and earn rewards!

Have you used MMRN1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes