MPRA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83224

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MPRA Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPRA. Peptide sequence: YEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MPRA Antibody - BSA Free

Western Blot: MPRA Antibody [NBP2-83224]

Western Blot: MPRA Antibody [NBP2-83224]

Western Blot: MPRA Antibody [NBP2-83224] - Host: Rabbit. Target Name: PAQR7. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

Applications for MPRA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MPRA

The steroid progesterone induces the resumption of maturation in oocytes via a nongenomic pathway through binding to a novel, membrane progestin receptor (mPR). This pathway inhibits adenylyl cyclase and reduces intracellular cAMP, and also activates mitogen-activated protein kinase to effect signal transduction pathways. Three distinct groups, designated alpha, beta and gamma, comprise this gene family. mPRalpha, also designated progestin and adipoQ receptor family member VII (PAQR7), consists of an extracellular N-terminus, an intracellular C-terminus, and seven transmembrane domains. It is expressed in ovary, testis, placenta, uterus and bladder. mPRbeta, also designated progestin and adipoQ receptor family member VIII (PAQR8), consists of eight putative transmembrane regions and an intracellular N-terminus that contains a leucine-rich motif. It is a 354 amino acid protein with a molecular mass of about 40 kDa and is expressed in brain and spinal cord. Both mPRalpha and mPRbeta may be G protein-coupled receptors and may be involved in oocyte maturation.

Alternate Names

membrane progestin receptor alpha, mPR alpha, MPRA2310021M12Rik, MRPA, mSR, Progestin and adipoQ receptor family member 7, progestin and adipoQ receptor family member VIIPGLP

Gene Symbol

PAQR7

Additional MPRA Products

Product Documents for MPRA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MPRA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MPRA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MPRA Antibody - BSA Free and earn rewards!

Have you used MPRA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies