MTF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86380

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse, Bovine

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence, Chemotaxis

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MTF1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%), (86%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MTF1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MTF1 Antibody [NBP1-86380]

Immunocytochemistry/ Immunofluorescence: MTF1 Antibody [NBP1-86380]

Immunocytochemistry/Immunofluorescence: MTF1 Antibody [NBP1-86380] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
MTF1 Antibody - BSA Free Western Blot: MTF1 Antibody - BSA Free [NBP1-86380]

Western Blot: MTF1 Antibody - BSA Free [NBP1-86380]

Analysis in human cell line HDLM-2.
MTF1 Antibody - BSA Free Western Blot: MTF1 Antibody - BSA Free [NBP1-86380]

Western Blot: MTF1 Antibody - BSA Free [NBP1-86380]

Analysis in control (vector only transfected HEK293T lysate) and MTF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for MTF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTF1

MTF1 encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE).

Alternate Names

metal regulatory transcription factor 1, metal-regulatory transcription factor 1, metal-responsive transcription factor 1, MGC23036, MRE-binding transcription factor, MRE-binding transcription factor-1, MTF-1, Transcription factor MTF-1, zinc regulatory factor, ZRF

Gene Symbol

MTF1

Additional MTF1 Products

Product Documents for MTF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MTF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MTF1 Antibody - BSA Free

Customer Reviews for MTF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTF1 Antibody - BSA Free and earn rewards!

Have you used MTF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies