MYL4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79617

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MYL4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human MYL4The immunogen for this antibody is MYL4. Peptide sequence MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MYL4 Antibody - BSA Free

Western Blot: MYL4 Antibody [NBP1-79617]

Western Blot: MYL4 Antibody [NBP1-79617]

Western Blot: MYL4 Antibody [NBP1-79617] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Applications for MYL4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MYL4

Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Alternate Names

ALC1, AMLC, GT1, MLC1, Myosin light chain 1, embryonic muscle/atrial isoform, myosin light chain 4, Myosin light chain alkali GT-1 isoform, myosin, atrial/fetal muscle, light chain, myosin, light chain 4, alkali; atrial, embryonic, myosin, light polypeptide 4, alkali; atrial, embryonic, PRO1957

Gene Symbol

MYL4

UniProt

NP_001002841 (Human)

Additional MYL4 Products

Product Documents for MYL4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MYL4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MYL4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MYL4 Antibody - BSA Free and earn rewards!

Have you used MYL4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies