Myosin Light Chain 2 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-85541PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYL2.

Source: E. coli

Amino Acid Sequence: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85541.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-85541PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Myosin Light Chain 2

MYL2 (myosin, light chain 2, regulatory, cardiac, slow), also known as MLC-2, MLC2v. Entrez protein NP_000423. MYL2 associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. It is an hexamer of two heavy chains and four light chains that is predominantly expressed in adult cardiac ventricle muscle. Mutations in MYL2 are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

Alternate Names

cardiac ventricular myosin light chain 2, CMH10myosin light chain 2, DKFZp779C0562, MLC2, MLC-2, MLC-2v, myosin regulatory light chain 2, ventricular/cardiac muscle isoform, myosin, light chain 2, regulatory, cardiac, slow, myosin, light polypeptide 2, regulatory, cardiac, slow, regulatory light chain of myosin, RLC of myosin, slow cardiac myosin regulatory light chain 2

Gene Symbol

MYL2

Additional Myosin Light Chain 2 Products

Product Documents for Myosin Light Chain 2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myosin Light Chain 2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin Light Chain 2 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Myosin Light Chain 2 Recombinant Protein Antigen and earn rewards!

Have you used Myosin Light Chain 2 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...