NAP1L4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86723

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NAP1L4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of NAP1L4. Peptide sequence: HDLERKYAALYQPLFDKRREFITGDVEPTDAESAWHSENEEEDKLAGDMK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NAP1L4 Antibody - BSA Free

Western Blot: NAP1L4 Antibody [NBP2-86723]

Western Blot: NAP1L4 Antibody [NBP2-86723]

Western Blot: NAP1L4 Antibody [NBP2-86723] - WB Suggested Anti-Nap1l4 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Liver

Applications for NAP1L4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NAP1L4

NAP1L4 (Nucleosome Assembly Protein 1-Like 4) is thought to have involvement as a histone chaperone. Due to its location near the imprinted gene domain of 11p15.5, NAP1L4 has been studied in relation to Wilms tumor, Beckwith-Wiedemann syndrome, rhabdomyosarcoma and several forms of cancer including breast, lung and ovarian cancer. NAP1L4 is known to have interactions with HIST1H4A, HIST2H4A, HIST1H4AB, HIST1H4C and HIST1H4D.

Alternate Names

hNAP2, MGC4565, NAP-2, NAP2L, NAP2NAP1L4b, nucleosome assembly protein 1-like 4, nucleosome assembly protein 1-like 4b, Nucleosome assembly protein 2

Gene Symbol

NAP1L4

Additional NAP1L4 Products

Product Documents for NAP1L4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NAP1L4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NAP1L4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NAP1L4 Antibody - BSA Free and earn rewards!

Have you used NAP1L4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies