Nbs1 Antibody (4G4R1)

Novus Biologicals | Catalog # NBP3-16355

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4G4R1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 655-754 of human Nbs1 (O60934). LLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Nbs1 Antibody (4G4R1)

Western Blot: Nbs1 Antibody (4G4R1) [NBP3-16355]

Western Blot: Nbs1 Antibody (4G4R1) [NBP3-16355]

Western Blot: Nbs1 Antibody (4G4R1) [NBP3-16355] - Western blot analysis of extracts of PC-3 cells, using Nbs1 Rabbit mAb (NBP3-16355) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunoprecipitation: Nbs1 Antibody (4G4R1) [NBP3-16355]

Immunoprecipitation: Nbs1 Antibody (4G4R1) [NBP3-16355]

Immunoprecipitation: Nbs1 Antibody (4G4R1) [NBP3-16355] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug Nbs1 antibody (NBP3-16355). Western blot was performed from the immunoprecipitate using Nbs1 antibody (NBP3-16355) at a dilition of 1:1000.

Applications for Nbs1 Antibody (4G4R1)

Application
Recommended Usage

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Nbs1

NBS1 (Nijmegen breakage syndrome protein 1, Nibrin) is the eukaryotic component of MRN complex (Mre11-Rad50-Nbs1) involved in homologous recombination repair for DNA double-strand breaks (DSBs) and DNA damage-induced checkpoint activation. NBS1, a nuclear protein with a theoretical molecular weight of 65-85 kDa, is composed of 2 functional regions: the forkhead associated (FHA) N-terminal domain (24-83 amino acids) and the breast cancer C-terminus (BRCT) domain (105-181 amino acids). Mutations in the NBN gene are associated with Nijmegen breakage syndrome, characterized by microcephaly, growth retardation, immunodeficiency, and an increased susceptibility to prostate cancer, lung cancer, liver cancer and intrahepatic cholangiocarcinoma (IHC) (1).

In DNA double strand break repair, the FHA/BRCT domains bind DNA damage sensor proteins including gamma H2AX (phospho Ser139), phosphorylated MDC1 and CtIP (CtBP-interacting protein). NBS1 then recruits the other members of the MRN complex, Mre11 and Rad50, to the proximity of DNA DSBs. The MRN complex has also been shown to interact with ATM or ATR kinases in the presence of DSBs or replication fork stalling, respectively. Phosphorylation of NBS1 at Ser 278 and Ser343 in response to ionizing radiation (IR) is dependent on ATM and is important for activation of the S phase checkpoint. The activation of ATM in response to DNA damage is also facilitated by MRN and may lead to induction of apoptosis (2, 3).

References

1. Bian L, Meng Y, Zhang M, Li D. (2019) MRE11-RAD50-NBS1 complex alterations and DNA damage response: implications for cancer treatment. Mol Cancer. 26;18(1):169. PMID: 31767017

2. Zhang Y, Zhou J, Lim CU. (2006) The role of NBS1 in DNA double strand break repair, telomere stability, and cell cycle checkpoint control. Cell Res. 16(1):45-54. PMID: 16467875

3. Komatsu K. NBS1 and multiple regulations of DNA damage response. (2016) J Radiat Res. 57 Suppl 1:i11-i17. PMID: 27068998

Long Name

Nijmegen Breakage Syndrome 1

Alternate Names

NBN, Nibrin, p95

Gene Symbol

NBN

Additional Nbs1 Products

Product Documents for Nbs1 Antibody (4G4R1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nbs1 Antibody (4G4R1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Nbs1 Antibody (4G4R1)

There are currently no reviews for this product. Be the first to review Nbs1 Antibody (4G4R1) and earn rewards!

Have you used Nbs1 Antibody (4G4R1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Nbs1 Antibody (4G4R1)

Showing  1 - 4 of 4 FAQs Showing All
  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: Yes, if this product is used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product.

  • Q: What is NBS1?

    A: NBS1 is Nijmegen breakage syndrome protein 1, or Nibrin. Please refer to the background listed in the datasheet for a full summary of this common name.

  • Q: What is the theoretical molecular weight of Nbs1 antibodies?

    A: In general, there is only one isoform described for this target. The TMW of the human form of the target protein is 85kDa. The mouse form is 84kDa. However, the observed molecular weight may vary.

  • Q: What research areas can this product be used in?

    A: All Nbs1 products can be used in Breast Cancer, Cancer, Checkpoint signaling, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Homologous Recombination, Non-homologous end-joining, Tumor Suppressors, and Cell Cycle and Replication.

  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: Yes, if this product is used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product.

  • Q: What is NBS1?

    A: NBS1 is Nijmegen breakage syndrome protein 1, or Nibrin. Please refer to the background listed in the datasheet for a full summary of this common name.

  • Q: What is the theoretical molecular weight of Nbs1 antibodies?

    A: In general, there is only one isoform described for this target. The TMW of the human form of the target protein is 85kDa. The mouse form is 84kDa. However, the observed molecular weight may vary.

  • Q: What research areas can this product be used in?

    A: All Nbs1 products can be used in Breast Cancer, Cancer, Checkpoint signaling, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Homologous Recombination, Non-homologous end-joining, Tumor Suppressors, and Cell Cycle and Replication.

  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: Yes, if this product is used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product.

  • Q: What is NBS1?

    A: NBS1 is Nijmegen breakage syndrome protein 1, or Nibrin. Please refer to the background listed in the datasheet for a full summary of this common name.

  • Q: What is the theoretical molecular weight of Nbs1 antibodies?

    A: In general, there is only one isoform described for this target. The TMW of the human form of the target protein is 85kDa. The mouse form is 84kDa. However, the observed molecular weight may vary.

  • Q: What research areas can this product be used in?

    A: All Nbs1 products can be used in Breast Cancer, Cancer, Checkpoint signaling, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Homologous Recombination, Non-homologous end-joining, Tumor Suppressors, and Cell Cycle and Replication.

  • Q: If this product is used in an application or species as a part of a customer review, will that validate this product in the application/species?

    A: Yes, if this product is used in an untested application or species and it is shown to work through images from customer reviews or through publications, this validates the application/species for this product.

  • Q: What is NBS1?

    A: NBS1 is Nijmegen breakage syndrome protein 1, or Nibrin. Please refer to the background listed in the datasheet for a full summary of this common name.

  • Q: What is the theoretical molecular weight of Nbs1 antibodies?

    A: In general, there is only one isoform described for this target. The TMW of the human form of the target protein is 85kDa. The mouse form is 84kDa. However, the observed molecular weight may vary.

  • Q: What research areas can this product be used in?

    A: All Nbs1 products can be used in Breast Cancer, Cancer, Checkpoint signaling, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Homologous Recombination, Non-homologous end-joining, Tumor Suppressors, and Cell Cycle and Replication.

Showing  1 - 4 of 4 FAQs Showing All
View all FAQs for Antibodies
Loading...