NCAPH2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57498

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NCAPH2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NCAPH2 Antibody - BSA Free

Western Blot: NCAPH2 Antibody [NBP2-57498]

Western Blot: NCAPH2 Antibody [NBP2-57498]

Western Blot: NCAPH2 Antibody [NBP2-57498] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: NCAPH2 Antibody [NBP2-57498]

Immunocytochemistry/ Immunofluorescence: NCAPH2 Antibody [NBP2-57498]

Immunocytochemistry/Immunofluorescence: NCAPH2 Antibody [NBP2-57498] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.

Applications for NCAPH2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NCAPH2

CAP-H2 (chromosome-associated protein H2) is 1 of 3 non-SMC subunits that define the condensin II complex. Condensin II along with the condensin I plays a critical role in mitotic chromosome assembly and segregation.

Alternate Names

CAP-H2, CAP-H2 subunit of the condensin II complex, CAPH2,384D8-2, Chromosome-associated protein H2, condensin-2 complex subunit H2, hCAP-H2, kleisin beta, Kleisin-beta, MGC15858, MGC18000, MGC2455, MGC4133, MGC5305, MGC8640, Non-SMC condensin II complex subunit H2, non-SMC condensin II complex, subunit H2

Gene Symbol

NCAPH2

Additional NCAPH2 Products

Product Documents for NCAPH2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NCAPH2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NCAPH2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NCAPH2 Antibody - BSA Free and earn rewards!

Have you used NCAPH2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies