Ndufs1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56520

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to NDUFS1 (NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)) The peptide sequence was selected from the middle region of NDUFS1)(50ug). Peptide sequence TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: mitochondrial.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Ndufs1 Antibody - BSA Free

Western Blot: Ndufs1 Antibody [NBP1-56520]

Western Blot: Ndufs1 Antibody [NBP1-56520]

Western Blot: Ndufs1 Antibody [NBP1-56520] - Lanes: Lane1 : 30 ug Human liver Lane2: 30 ug Rat liver Lane3: 30 ug Mouse (wild-type) liver Lane4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liver Lane5: 30 ug Human muscle Lane6: 30 ug Rat muscle Lane7: 30 ug Mouse muscle Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Secondary, Antibody Dilution: 1 : 10000 Gene name: NDUFS1.
Western Blot: Ndufs1 Antibody [NBP1-56520]

Western Blot: Ndufs1 Antibody [NBP1-56520]

Western Blot: Ndufs1 Antibody [NBP1-56520] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Western Blot: Ndufs1 Antibody [NBP1-56520]

Western Blot: Ndufs1 Antibody [NBP1-56520]

Western Blot: Ndufs1 Antibody [NBP1-56520] - Nuclear lysates at 1:1000.

Applications for Ndufs1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP1-56520 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ndufs1

The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Long Name

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Alternate Names

CI-75kD, Complex I-75kD, EC 7.1.1.2

Gene Symbol

NDUFS1

UniProt

Additional Ndufs1 Products

Product Documents for Ndufs1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ndufs1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Ndufs1 Antibody - BSA Free

Customer Reviews for Ndufs1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Ndufs1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card
Showing  1 - 1 of 1 review Showing All
Filter By:
  • Ndufs1 Antibody
    Name: zhenqi zhou
    Application: Western Blot
    Sample Tested: skeletal muscle mitochondria
    Species: Mouse
    Verified Customer | Posted 03/12/2019

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...