NDUFV2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79680

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human Ndufv2The immunogen for this antibody is Ndufv2. Peptide sequence DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NDUFV2 Antibody - BSA Free

Western Blot: NDUFV2 Antibody [NBP1-79680]

Western Blot: NDUFV2 Antibody [NBP1-79680]

Western Blot: NDUFV2 Antibody [NBP1-79680] - Mouse Brain Lysate 1ug/ml Gel Concentration 10-20%

Applications for NDUFV2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFV2

NDUFV2 is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Complex I is composed of 45 different subunits. This is a component of the flavoprotein-sulfur (FP) fragment of the enzyme.

Alternate Names

CI-24k, mitochondrial respitory chain, 24 kD subunit, NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD), NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa, NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial, NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial, NADH-ubiquinone oxidoreductase 24 kDa subunit, NADH-ubiquinone oxidoreductase flavoprotein 2, nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit

Gene Symbol

NDUFV2

Additional NDUFV2 Products

Product Documents for NDUFV2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFV2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFV2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFV2 Antibody - BSA Free and earn rewards!

Have you used NDUFV2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...