NELL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59273

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Microarray

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NELL2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NELL2(NEL-like 2 (chicken)) The peptide sequence was selected from the N terminal of NELL2. Peptide sequence MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NELL2 Antibody - BSA Free

Western Blot: NELL2 Antibody [NBP1-59273]

Western Blot: NELL2 Antibody [NBP1-59273]

Western Blot: NELL2 Antibody [NBP1-59273] - Transfected 293T cell lysate. Antibody at 5 ug/mL.
Microarray: NELL2 Antibody [NBP1-59273]

Microarray: NELL2 Antibody [NBP1-59273]

Microarray: NELL2 Antibody [NBP1-59273] - Antibody was printed on custom arrays and incubated with fluorescently labeled human EDTA plasma. Microarray image submitted by a verified customer review.

Applications for NELL2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
This NELL2 Antibody is validated for microarray from a verfied customer review.

Reviewed Applications

Read 1 review rated 4 using NBP1-59273 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NELL2

NELL2 is a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. Heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis.This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF) -like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. An alternative splice variant has been described but its full length sequence has not been determined.

Long Name

NEL-like 2

Alternate Names

Mel91, NRP2

Gene Symbol

NELL2

UniProt

Q99435 (Human)

Additional NELL2 Products

Product Documents for NELL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NELL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NELL2 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used NELL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • NELL2 Antibody
    Name: Anonymous
    Application: Microarray
    Sample Tested: EDTA Plasma
    Species: Human
    Verified Customer | Posted 12/07/2020
    Antibody was printed on custom arrays and incubated with fluorescently labeled human EDTA plasma
    NELL2 Antibody - BSA Free NBP1-59273

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies