Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93230

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Neuromedin U R2/NMUR2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 326-415 of human NMUR2 (NP_064552.3). IYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free

Western Blot: Neuromedin UR2/NMUR2 AntibodyAzide and BSA Free [NBP2-93230]

Western Blot: Neuromedin UR2/NMUR2 AntibodyAzide and BSA Free [NBP2-93230]

Western Blot: Neuromedin UR2/NMUR2 Antibody [NBP2-93230] - Analysis of extracts of various cell lines, using Neuromedin UR2/NMUR2 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Applications for Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Neuromedin U R2/NMUR2

Neuromedin U Receptor 2 is a Neuromedin Receptor. NMU2R may mediate the contractile activity of neuromedin U in the uterus. Neuromedin U Receptor 2 has been reported in the central nervous system and in the uterus. ESTs have been isolated from diseased brain and colon carcinoma libraries.

Long Name

Neuromedin U Receptor 2

Alternate Names

FM4, Neuromedin UR2, NMU2R, NMUR2, TGR1

Gene Symbol

NMUR2

Additional Neuromedin U R2/NMUR2 Products

Product Documents for Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free and earn rewards!

Have you used Neuromedin UR2/NMUR2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies