Catalog Number: 1153
Alternate Names: NPY (human, rat)
Biological Activity
Widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure.
Technical Data
  • M.Wt:
    4271.7
  • Formula:
    C189H285N55O57S
  • Sequence:
    YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

    (Modifications: Tyr-36 = C-terminal amide)

  • Solubility:
    Soluble to 1.50 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    90880-35-6
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Molecular structure of mammalian neuropeptide Y: analysis by molecular cloning and computer-aided comparison with crystal structure of avian homologue.
    Allen et al.
    Proc.Natl.Acad.Sci.U.S.A., 1987;84:2532
  2. Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine.
    Minth et al.
    Proc.Natl.Acad.Sci.U.S.A., 1984;81:4577
  3. XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors.
    Michel et al.
    Pharmacol.Rev., 1998;50:143
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Neuropeptide Y (human, rat) include:

1 Citations: Showing 1 - 1

  1. Neuropeptide Y is produced by adipose tissue macrophages and regulates obesity-induced inflammation.
    Authors: Singer Et al.
    PLoS One 2013;8:e57929

Have you used Neuropeptide Y (human, rat)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information