Neuropeptide Y (human, rat)

  ( 1 citations ) ( 1 Review )    
Product Datasheet
Catalog Number:1153
Alternate Names:NPY (human, rat)
Chemical Name:
Product Details
Citations (1)
Supplemental Products
Reviews
Biological Activity
Widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure.
Technical Data
  • M.Wt:
    4271.7
  • Formula:
    C189H285N55O57S
  • Sequence:
    YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

    (Modifications: Tyr-36 = C-terminal amide)

  • Solubility:
    Soluble to 1.50 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    90880-35-6
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Neuropeptide Y (human, rat) include:

1 Citations: Showing 1 - 1

  1. Neuropeptide Y is produced by adipose tissue macrophages and regulates obesity-induced inflammation.
    Authors: Singer Et al.
    PLoS One  2013;8:e57929

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs
Average Rating: 5 (Based on 1 review)

Have you used Neuropeptide Y (human, rat)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Read what people are saying who have used Neuropeptide Y (human, rat).

We have 1 review tested in 1 species: Mouse.

Filter by Ratings
Excellent
(1)
All Ratings
Filter by Applications
All Applications
Filter by Species
Mouse
(1)
All Species

Images Ratings Applications Species Reviewed By Date Details
  Excellent
  Mouse Aundrea Bartley 01/05/2018
Show

Summary

Species Mouse

Other Experimental Details

Other Experimental Details We precoated the tubing with 0.1 mg/ml of BSA to prevent issues of NPY sticking to the tubing. BSA cannot be added directly to the recording solution because of issues that arise during oxygenation.

Please scroll the above reviews for more
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee