NGFI-B alpha/Nur77/NR4A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58600

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (92%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NGFI-B alpha/Nur77/NR4A1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NGFI-B alpha/Nur77/NR4A1 Antibody - BSA Free

Western Blot: NGFI-B alpha/Nur77/NR4A1 Antibody [NBP2-58600]

Western Blot: NGFI-B alpha/Nur77/NR4A1 Antibody [NBP2-58600]

Western Blot: NGFI-B alpha/Nur77/NR4A1 Antibody [NBP2-58600] - Analysis in human cell line SK-MEL-30 and human cell line PC-3.
Immunocytochemistry/ Immunofluorescence: NGFI-B alpha/Nur77/NR4A1 Antibody [NBP2-58600]

Immunocytochemistry/ Immunofluorescence: NGFI-B alpha/Nur77/NR4A1 Antibody [NBP2-58600]

Immunocytochemistry/Immunofluorescence: NGFI-B alpha/Nur77/NR4A1 Antibody [NBP2-58600] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Applications for NGFI-B alpha/Nur77/NR4A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NGFI-B alpha/Nur77/NR4A1

Nak1 is a member of the steroid/thyroid hormone receptor superfamily. The gene for Nak-1 is induced rapidly by androgens/growth factors and may have functions related to cell proliferation, differentiation and apoptosis (1). Liu et al (2) have demonstrated that mouse nur77 is necessary for induced apoptosis in T-cell hybridomas and can also be induced during early mitogenesis. Nak1 is a phosphoprotein and its size ranges from 67 kD to 88 kD, depending on post-translational modifications.

Long Name

Nerve Growth Factor-induced Protein I-B alpha/Nuclear Receptor Subfamily 4, Group A, Member 1

Alternate Names

HMR, NAK1, NGFIB alpha, NR4A1, Nur77, TR3

Gene Symbol

NR4A1

Additional NGFI-B alpha/Nur77/NR4A1 Products

Product Documents for NGFI-B alpha/Nur77/NR4A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NGFI-B alpha/Nur77/NR4A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NGFI-B alpha/Nur77/NR4A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NGFI-B alpha/Nur77/NR4A1 Antibody - BSA Free and earn rewards!

Have you used NGFI-B alpha/Nur77/NR4A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies