Niemann-Pick type C1 Like-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94542

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Niemann-Pick type C1 Like-1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1030-1100 of human Niemann-Pick type C1 Like-1 (NP_001095118.1). AAYSTSVNLTSDGQVLASRFMAYHKPLKNSQDYTEALRAARELAANITADLRKVPGTDPAFEVFPYTITNV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Niemann-Pick type C1 Like-1 Antibody - BSA Free

Niemann-Pick type C1 Like-1 Antibody - BSA Free

Western Blot: Niemann-Pick type C1 Like-1 Antibody - BSA Free [Niemann-Pick type C1 Like-1] -

Western Blot: Niemann-Pick type C1 Like-1 Antibody - BSA Free [Niemann-Pick type C1 Like-1] - Western blot analysis of lysates from HepG2 cells, using Niemann-Pick type C1 Like-1 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for Niemann-Pick type C1 Like-1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Niemann-Pick type C1 Like-1

Dietary consumption and intestinal cholesterol absorption contribute to plasma cholesterol levels, which factor into the risk of coronary heart disease. Niemann-Pick type C1 Like 1 protein (NPC1L1 or NPC3) is enriched in the small intestine and is found in the brush border membrane of enterocytes. It plays a critical role in absorption of intestinal cholesterol.

Alternate Names

Niemann-Pick C1-like protein 1, NPC1 (Niemann-Pick disease, type C1, gene)-like 1, NPC11L1

Gene Symbol

NPC1L1

Additional Niemann-Pick type C1 Like-1 Products

Product Documents for Niemann-Pick type C1 Like-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Niemann-Pick type C1 Like-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Niemann-Pick type C1 Like-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Niemann-Pick type C1 Like-1 Antibody - BSA Free and earn rewards!

Have you used Niemann-Pick type C1 Like-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies