NLRX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87928

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NLRX1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NLRX1. Peptide sequence: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NLRX1 Antibody - BSA Free

Western Blot: NLRX1 Antibody [NBP2-87928]

Western Blot: NLRX1 Antibody [NBP2-87928]

Western Blot: NLRX1 Antibody [NBP2-87928] - Sample Type: Lane 1: 35ug mouse neuroblastoma cells w/ empty vector Lane 2: 35ug mouse neuroblastoma cells w/ NLRX1 siRNA Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:1000 Color/Signal Descriptions

Applications for NLRX1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NLRX1

NLRX1 encodes a member of the NLR family. Alternative splicing has been observed at this gene locus and two transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

Alternate Names

Caterpiller protein 11.3, CLR11.3DLNB26, MGC131937, MGC21025, NLR family member X1, NLR family, X1, NOD26, NOD5, NOD9FLJ21478, NOD-like receptor X1, Nucleotide-binding oligomerization domain protein 26, Nucleotide-binding oligomerization domain protein 5, Nucleotide-binding oligomerization domain protein 9, nucleotide-binding oligomerization domain, leucine rich repeat containing X1

Gene Symbol

NLRX1

Additional NLRX1 Products

Product Documents for NLRX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NLRX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NLRX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NLRX1 Antibody - BSA Free and earn rewards!

Have you used NLRX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies