non-muscle heavy chain 10 Myosin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38566

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all non-muscle heavy chain 10 Myosin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for non-muscle heavy chain 10 Myosin Antibody - BSA Free

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Analysis in human placenta and skeletal muscle tissues. Corresponding MYH10 RNA-seq data are presented for the same tissues.
Western Blot: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Western Blot: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Western Blot: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Analysis in human cell lines HEK293 and PC-3 using anti-MYH10 antibody. Corresponding MYH10 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566]

Immunohistochemistry-Paraffin: non-muscle heavy chain 10 Myosin Antibody [NBP2-38566] - Staining of human kidney shows moderate membranous positivity in cells in tubules.

Applications for non-muscle heavy chain 10 Myosin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: non-muscle heavy chain 10 Myosin

Myosin II is a hexameric protein that consist of a pair of heavy chain subunits (MHC), a pair of essential light chain subunits (MLC), and a pair of regulatory light chain subunits (RLCs). Non-muscle myosin heavy chain II-B is encoded by the myosin heavy chain 10 gene (MYH10) and non-muscle myosin heavy chain II-A is encoded by the Myosin heavy chain 9 gene (MYH9). Myosin in non-muscle cells is involved in motile cellular processes which include cytokinesis, cell shape, secrection, and capping. Alternate names for Myosin-10 is Myosin heavy chain II-B, cellular myosin heavy chain type B, and NMMHCB.

Long Name

Myosin-10

Alternate Names

MYH10, NMMHC II-b, NMMHC-B, NMMHC-IIB

Gene Symbol

MYH10

UniProt

P35580 (Human)

Additional non-muscle heavy chain 10 Myosin Products

Product Documents for non-muscle heavy chain 10 Myosin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for non-muscle heavy chain 10 Myosin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for non-muscle heavy chain 10 Myosin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review non-muscle heavy chain 10 Myosin Antibody - BSA Free and earn rewards!

Have you used non-muscle heavy chain 10 Myosin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies