NPBWR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82292

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GPR7/NPBWR1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPBWR1. Peptide sequence: FSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NPBWR1 Antibody - BSA Free

Western Blot: NPBWR1 Antibody [NBP2-82292]

Western Blot: NPBWR1 Antibody [NBP2-82292]

Western Blot: NPBWR1 Antibody [NBP2-82292] - WB Suggested Anti-NPBWR1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain

Applications for NPBWR1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR7/NPBWR1

GPR7 is a Neuropeptide Receptor GPCR. GPR7 is implicated in the regulation of feeding, neuroendorine system, memory, and learning. GPR7 has been reported in brain, mainly cerebellum and frontal cortex, and in the pituitary (O'Dowd et al., 1995). The mouse ortholog of GPR7 was shown by in situ hybridization to be expressed in discrete nuclei of brain, namely suprachiasmatic, arcuate, and ventromedial nuclei of hypothalamus.

Long Name

G Protein-coupled Receptor 7 / Neuropeptides B/W Receptor 1

Alternate Names

NPBWR1, Opioid-Somatostatin-Like Receptor 7

Gene Symbol

NPBWR1

Additional GPR7/NPBWR1 Products

Product Documents for NPBWR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NPBWR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NPBWR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NPBWR1 Antibody - BSA Free and earn rewards!

Have you used NPBWR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies