NRAMP2/SLC11A2/DMT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59869

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NRAMP2/SLC11A2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC11A2 The peptide sequence was selected from the N terminal of SLC11A2 (NP_000608). Peptide sequence VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF. The peptide sequence for this immunogen was taken from within the described region.

Specificity

Specific to all four isoforms of the SLC11A2 transporter.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NRAMP2/SLC11A2/DMT1 Antibody - BSA Free

Western Blot: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-59869]

Western Blot: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-59869]

Western Blot: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-59869] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-59869]

Western Blot: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-59869]

Western Blot: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-59869] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for NRAMP2/SLC11A2/DMT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 2 reviews rated 4 using NBP1-59869 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NRAMP2/SLC11A2

The SLC11A2 is a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body.The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Natural Resistance-associated Macrophage Protein 2

Alternate Names

DCT1, SLC11A2

Entrez Gene IDs

4891 (Human)

Gene Symbol

SLC11A2

UniProt

Q498Z5 (Human)

Additional NRAMP2/SLC11A2 Products

Product Documents for NRAMP2/SLC11A2/DMT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NRAMP2/SLC11A2/DMT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NRAMP2/SLC11A2/DMT1 Antibody - BSA Free

Customer Reviews for NRAMP2/SLC11A2/DMT1 Antibody - BSA Free (2)

4 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
0%
3 Stars
50%
2 Stars
0%
1 Stars
0%

Have you used NRAMP2/SLC11A2/DMT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • NRAMP2/SLC11A2/DMT1 Antibody
    Name: Anonymous
    Application: Immunohistochemistry
    Sample Tested: Mouse brain
    Species: Mouse
    Verified Customer | Posted 06/27/2017
    NRAMP2/SLC11A2/DMT1 Antibody - BSA Free NBP1-59869
  • NRAMP2/SLC11A2/DMT1 Antibody
    Name: Ajay Ashok
    Application: Western Blot
    Sample Tested: Adult brain
    Species: Human
    Verified Customer | Posted 06/13/2017
    NRAMP2/SLC11A2/DMT1 Antibody - BSA Free NBP1-59869

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

FAQs for NRAMP2/SLC11A2/DMT1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Do you have a primary anti-DMT1 antibody against mouse for Western Blot?

    A: We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an Innovators Reward Program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies