NRIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55070

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NRIP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EDVTKYQEGVSAENPVENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQFQTEATG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NRIP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NRIP Antibody [NBP2-55070]

Immunocytochemistry/ Immunofluorescence: NRIP Antibody [NBP2-55070]

Immunocytochemistry/Immunofluorescence: NRIP Antibody [NBP2-55070] - Staining of human cell line U-2 OS shows localization to nucleus, cytosol & focal adhesion sites.

Applications for NRIP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NRIP

WD-repeat proteins are a large family of eukaryotic proteins coordinating multi-protein complex assemblies. Their role has been implicated in multiple cellular processes including signal transduction, transcriptional regulation, cell cycle control and apoptosis. NRIP is a novel 860a.a nuclear protein consisting of seven conserved WD40 domains and one NLS motif. It binds to androgen and glucocorticoid receptors and up-regulates their transcriptional activity, thereby functioning as a nuclear receptor co-activator. Role of NRIP has been implicated in cell growth and also in cervical and prostrate cancer, thus indicating a potential therapeutic intervention. Northern Blot analysis detects a high expression of NRIP in skeletal muscle and testis and low expression in heart, prostrate and adrenal gland.

Alternate Names

1200006M05Rik, Androgen receptor complex-associated protein, ARCAP, DDB1 and CUL4 associated factor 6, DDB1- and CUL4-associated factor 6, FLJ23798, IQ motif and WD repeat-containing protein 1, IQ motif and WD repeats 1, IQWD1, MSTP055, NRIP, Nuclear receptor interaction protein, PC326

Gene Symbol

DCAF6

Additional NRIP Products

Product Documents for NRIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NRIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NRIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NRIP Antibody - BSA Free and earn rewards!

Have you used NRIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies