NRL Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82293

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NRL Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NRL. Peptide sequence: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NRL Antibody - BSA Free

Western Blot: NRL Antibody [NBP2-82293]

Western Blot: NRL Antibody [NBP2-82293]

Western Blot: NRL Antibody [NBP2-82293] - Host: Rabbit. Target Name: NRL. Sample Type: Esophagus Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for NRL Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NRL

The NRL gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been as

Long Name

Neural Retina-specific Leucine Zipper Protein

Alternate Names

RP27

Gene Symbol

NRL

Additional NRL Products

Product Documents for NRL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NRL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NRL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NRL Antibody - BSA Free and earn rewards!

Have you used NRL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies