NUDCD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09934

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NUDCD3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for Anti-NUDCD3 antibody is: synthetic peptide directed towards the middle region of Human NUDC3 (NP_056147.2). Peptide sequence AHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYTW

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NUDCD3 Antibody - BSA Free

Western Blot: NUDCD3 Antibody [NBP3-09934]

Western Blot: NUDCD3 Antibody [NBP3-09934]

Western Blot: NUDCD3 Antibody [NBP3-09934] - Western blot analysis of NUDCD3 in Human Fetal Liver. Antibody dilution at 1 ug/mL

Applications for NUDCD3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUDCD3

The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, and loss of gamma-tubulin from spindle poles. The protein localizes to the Golgi apparatus during interphase, and levels of the protein increase after the G1/S transition. [provided by RefSeq]

Alternate Names

KIAA1068NudCL, NudC domain containing 3, nudC domain-containing protein 3, NudC-like protein

Gene Symbol

NUDCD3

Additional NUDCD3 Products

Product Documents for NUDCD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUDCD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUDCD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUDCD3 Antibody - BSA Free and earn rewards!

Have you used NUDCD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies