Recombinant Human OA1 Protein

Name: Recombinant Human OA1 Protein
Brand: Novus Biologicals
SKU: H00004935-G01
Price: 789 USD
Availability: InStock

Novus Biologicals | Catalog # H00004935-G01

Submit a review

Product Documents

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Applications

Affinity Purification

View all OA1/GPR143 Proteins and Enzymes »

Product Specifications

Description

An untagged recombinant protein corresponding to the amino acid sequence of (NP_000264.1) for Human OA1

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

46.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation, and Storage

H00004935-G01

Preparation Method	in vitro wheat germ expression system with proprietary liposome technology
Formulation	25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative	Glycerol
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: OA1/GPR143

Ocular albinism type 1 protein is a conserved integral membrane protein with seven transmembrane domains. It is expressed in the eye and epidermal melanocytes. [provided by RefSeq]

Long Name

Ocular Albinism 1/G Protein-Coupled Receptor 143

Alternate Names

NYS6, OA1

Gene Symbol

GPR143

Additional OA1/GPR143 Products

Product Documents for Recombinant Human OA1 Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human OA1 Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human OA1 Protein

There are currently no reviews for this product. Be the first to review Recombinant Human OA1 Protein and earn rewards!

Have you used Recombinant Human OA1 Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image