OCTN2/SLC22A5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83304

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OCTN2/SLC22A5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of OCTN2/SLC22A5. Peptide sequence: TLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKST The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for OCTN2/SLC22A5 Antibody - BSA Free

Western Blot: OCTN2/SLC22A5 Antibody [NBP2-83304]

Western Blot: OCTN2/SLC22A5 Antibody [NBP2-83304]

Western Blot: OCTN2/SLC22A5 Antibody [NBP2-83304] - WB Suggested Anti-SLC22A5 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellSLC22A5 is supported by BioGPS gene expression data to be expressed in HeLa

Applications for OCTN2/SLC22A5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OCTN2/SLC22A5

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy. [provided by RefSeq]

Long Name

Solute Carrier Family 22 (Organic Cation/Carnitin Transporter) Member 5

Alternate Names

CDSP, OCTN2VT, SCD, SLC22A5

Gene Symbol

SLC22A5

Additional OCTN2/SLC22A5 Products

Product Documents for OCTN2/SLC22A5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OCTN2/SLC22A5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for OCTN2/SLC22A5 Antibody - BSA Free

Customer Reviews for OCTN2/SLC22A5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OCTN2/SLC22A5 Antibody - BSA Free and earn rewards!

Have you used OCTN2/SLC22A5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies