Oncomodulin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14568

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Oncomodulin Antibody - BSA Free (NBP2-14568) is a polyclonal antibody validated for use in IHC. Anti-Oncomodulin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Oncomodulin Antibody - BSA Free

Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568]

Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568]

Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568]

Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568]

Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in cells in molecular layer.
Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568]

Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568]

Immunohistochemistry-Paraffin: Oncomodulin Antibody [NBP2-14568] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Oncomodulin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Oncomodulin

Oncomodulin (OM; also parvalbumin beta) is a 12-14 kDa member of the parvalbumin family of Ca++ binding proteins. It is expressed in early embryonic cells, placenta, and in tumors. OM was originally thought to have expression restricted to neoplastic tissues, early embryonic cells and certain tumor cell lines. Recent research shows that oncomodulin is also expressed and secreted by macrophages where, in the retina, it binds to retinal ganglion cells (RGCs) and functions to promote axon regenerationin early embryonic cells, placenta, and in tumors. OM is both cytoplasmic, and secreted. Rat OM is 109 amino acids (aa) in length. It contains a vestigial Ca++ binding site (aa 7-33) and two EF hand domains, the latter of which contains one high affinity Ca++ binding site (aa 81-108). Relative to parvalbumin alpha, OM has a lower pI (4.8), a higher affinity for Ca++, and they share only 50% aa identity. Full length rat OM shares 95% and 89% aa identity with mouse and human OM, respectively.

Alternate Names

OCM, OCM1, OCMN, OM, ONCM, Parvalbumin beta

Gene Symbol

OCM

Additional Oncomodulin Products

Product Documents for Oncomodulin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Oncomodulin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Oncomodulin Antibody - BSA Free

Customer Reviews for Oncomodulin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Oncomodulin Antibody - BSA Free and earn rewards!

Have you used Oncomodulin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...