p14ARF/CDKN2A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-05521

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for p14ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: p14ARF/CDKN2A Antibody [NBP3-05521]

Immunocytochemistry/ Immunofluorescence: p14ARF/CDKN2A Antibody [NBP3-05521]

Immunocytochemistry/Immunofluorescence: p14ARF/CDKN2A Antibody [NBP3-05521] - Staining of human cell line PC-3 shows localization to nucleoli.

Applications for p14ARF/CDKN2A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
For ICC/IF fixation permeabilization use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: p14ARF/CDKN2A

P14ARF is an alternate reading frame (ARF) product of the CDKN2A locus, which acts as a tumor suppressor by inducing cell cycle arrest in G1 and G2 phases and apoptosis.

The INK4a-ARF locus is comprised of two tumor suppressors, p16INK4a and p14ARF. These two proteins are encoded by differential splicing of alternative first exons. The p16INK4a (exon 1 alpha) protein inhibits the cyclin D-dependent kinases (CDK) that control the phosphorylation of the Rb protein and cell proliferation. The p14ARF protein complexes with MDM2 within the nucleus, thus modulating the activity of the p53 protein. P14ARF is a potent tumor suppressor in the presence of wild-type p53, while mutant p53 substantially reduces growth inhibition by p14ARF.

Alternate Names

ARF, CDK4 inhibitor p16-INK4, CDK4IP14ARF, CDKN2, cell cycle negative regulator beta, CMM2P16-INK4A, Cyclin-dependent kinase 4 inhibitor A, cyclin-dependent kinase inhibitor 2A, cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4), INK4, INK4a, MLMP16INK4, MTS-1, MTS1P14, Multiple tumor suppressor 1, p14, p14ARF, P16, p16-INK4, p16INK4a, p16-INK4a, P19, P19ARF, TP16

Gene Symbol

CDKN2A

Additional p14ARF/CDKN2A Products

Product Documents for p14ARF/CDKN2A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for p14ARF/CDKN2A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for p14ARF/CDKN2A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review p14ARF/CDKN2A Antibody - BSA Free and earn rewards!

Have you used p14ARF/CDKN2A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...