P2Y6/P2RY6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82301

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all P2Y6/P2RY6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human P2RY6. Peptide sequence: NLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for P2Y6/P2RY6 Antibody - BSA Free

Western Blot: P2Y6/P2RY6 Antibody [NBP2-82301]

Western Blot: P2Y6/P2RY6 Antibody [NBP2-82301]

Western Blot: P2Y6/P2RY6 Antibody [NBP2-82301] - Host: Rabbit. Target Name: P2RY6. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/mlP2RY6 is supported by BioGPS gene expression data to be expressed in MCF7

Applications for P2Y6/P2RY6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: P2Y6/P2RY6

The purinergic receptor P2Y6 (P2RY6) is a member of the Purinergic Receptor subfamily. P2 receptors mediate a wide variety of physiologic effects in response to extracellular nucleotides. P2Y6 is believed to play a role in placental function and innate immune defense. P2Y6 expression has been documented in various blood cells, bone marrow, brain, colon, heart, kidney, ovary, placenta, spleen,and thymus. ESTs have been isolated from cervix, embryo, eye, kidney, liver/spleen, placenta, and vessel libraries.

Long Name

P2Y Purinergic Receptor 6

Alternate Names

P2RY6

Gene Symbol

P2RY6

Additional P2Y6/P2RY6 Products

Product Documents for P2Y6/P2RY6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for P2Y6/P2RY6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for P2Y6/P2RY6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review P2Y6/P2RY6 Antibody - BSA Free and earn rewards!

Have you used P2Y6/P2RY6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies