PACAP 1-38

  ( 2 citations )    
Product Datasheet
Catalog Number:1186
Alternate Names:Pituitary Adenylate Cyclase-Activating Polypeptide 1-38
Chemical Name:
Product Details
Citations (2)
Reviews
Biological Activity
Endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP) but with a greater potency for stimulation of adenylyl cyclase.
Technical Data
  • M.Wt:
    4535
  • Formula:
    C203H331N63O53S
  • Sequence:
    HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

    (Modifications: Lys-38 = C-terminal amide)

  • Solubility:
    Soluble to 0.90 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    137061-48-4
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for PACAP 1-38 include:

2 Citations: Showing 1 - 2
Filter your results:

  1. Pituitary adenylate cyclase-activating polypeptide protects glomerular podocytes from inflammatory injuries.
    Authors: Sakamoto Et al.
    J Diabetes Res  2015;2015:727152
  2. Regulation of angiotensin II type 2 receptor gene expression in the adrenal medulla by acute and repeated immobilization stress.
    Authors: Nostramo Et al.
    J Cereb Blood Flow Metab  2012;215:291

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used PACAP 1-38?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee