PAGE4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10548

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PAGE4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PAGE4 (XP_005278137). Peptide sequence DGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDC

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PAGE4 Antibody - BSA Free

Western Blot: PAGE4 Antibody [NBP3-10548]

Western Blot: PAGE4 Antibody [NBP3-10548]

Western Blot: PAGE4 Antibody [NBP3-10548] - Western blot analysis of PAGE4 in Thymus Tumor lysates. Antibody dilution at 1.0ug/ml

Applications for PAGE4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAGE4

PAGE4 is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq]

Alternate Names

CT16.7, G antigen family C member 1, G antigen, family C, 1, GAGEC1GAGE-9, JM-27, P antigen family, member 4 (prostate associated), PAGE-1, PAGE-4FLJ35184, Prostate-associated gene 4 protein, prostate-associated gene protein 4

Gene Symbol

PAGE4

Additional PAGE4 Products

Product Documents for PAGE4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAGE4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAGE4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAGE4 Antibody - BSA Free and earn rewards!

Have you used PAGE4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies