Pancreatic Polypeptide (human)

Catalog # Availability Size / Price Qty
1154/200U
Pancreatic Polypeptide (human)
1 Image
Description: NPY Y4 agonist; involved in gastrointestinal tract function
Product Details
Supplemental Products
Reviews (1)

Biological Activity

Endogenous high affinity agonist for human NPY Y4 receptor (Ki = 0.056 nM). Believed to play an important role in the function of the gastrointestinal tract.

Technical Data

M.Wt:
4181.7
Formula:
C185H287N53O54S2
Sequence:
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY

(Modifications: Tyr-36 = C-terminal amide)

Solubility:
Soluble to 0.70 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
75976-10-2

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

VersaClone cDNA Plasmids

Reviews for Pancreatic Polypeptide (human)

Average Rating: 4 (Based on 1 Review)

5 Star
0%
4 Star
100%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Pancreatic Polypeptide (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


For pancreatic cancer detection
By Anonymous on 07/16/2018
Application: Species: Human

Good quality, I gave 4 stars because the delivery was without ice


Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.