PBXIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38579

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PBXIP1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PBXIP1 (NP_065385.2).

Sequence:
MASCPDSDNSWVLAGSESLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGEGTLFQTESPQSGSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLEGQSPPQSLPSTPKAAWIREEGRCSSSDDDTDVDMEGLRRRRGREAGPPQPMVPLAVENQAGGEGAGGE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PBXIP1 Antibody - BSA Free

PBXIP1 Antibody

Western Blot: PBXIP1 Antibody [NBP3-38579] -

Western Blot: PBXIP1 Antibody [NBP3-38579] - Western blot analysis of various lysates using PBXIP1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for PBXIP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PBXIP1

Hematopoietic PBX-interacting protein (HPIP) was identified in a yeast two-hybrid screen for factors that interact with PBX1, a homeodomain protein that regulates gene transcription during development and differentiation. Recently, HPIP has been reported to interact with estrogen receptor alpha (ERalpha) and estrogen receptor beta (ERbeta) and modulate ER target gene expression. Alternate names for HPIP include pre-b-cell leukemia transcription factor-interacting protein 1, hematopoietic PBX-interacting protein, and PBKIP1.

Alternate Names

Hematopoietic PBX-interacting protein, HPIPpre-B-cell leukemia transcription factor interacting protein 1, pre-B-cell leukemia homeobox interacting protein 1, pre-B-cell leukemia transcription factor-interacting protein 1

Gene Symbol

PBXIP1

Additional PBXIP1 Products

Product Documents for PBXIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PBXIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PBXIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PBXIP1 Antibody - BSA Free and earn rewards!

Have you used PBXIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies