PCBD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-74264

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PCBD2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the N terminal of PCBD2. Immunizing peptide sequence SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PCBD2 Antibody - BSA Free

Western Blot: PCBD2 Antibody [NBP1-74264]

Western Blot: PCBD2 Antibody [NBP1-74264]

Western Blot: PCBD2 Antibody [NBP1-74264] - Human Fetal Small Intestine Cell Lysate, concentration 1 ug/ml.

Applications for PCBD2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCBD2

PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2.

Alternate Names

4-alpha-hydroxy-tetrahydropterin dehydratase 2, DCOH2DCOHMPHS2,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2, DcoH-like protein DCoHm, dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle, dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1), Dimerization cofactor of hepatocyte nuclear factor 1 from muscle, EC 4.2.1.96, HNF-1-alpha dimerization cofactor, PHS 2, pterin-4 alpha-carbinolamine dehydratase 2, pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2, pterin-4-alpha-carbinolamine dehydratase 2

Gene Symbol

PCBD2

UniProt

Q9H0N5 (Human)

Additional PCBD2 Products

Product Documents for PCBD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PCBD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCBD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCBD2 Antibody - BSA Free and earn rewards!

Have you used PCBD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies