PCMT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38309

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 62-286 of human PCMT1 (NP_001238978.1).

Sequence:
KSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRDEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PCMT1 Antibody - BSA Free

PCMT1 Antibody

Immunocytochemistry/ Immunofluorescence: PCMT1 Antibody [NBP3-38309] -

Immunocytochemistry/ Immunofluorescence: PCMT1 Antibody [NBP3-38309] - Immunofluorescence analysis of HeLa cells using PCMT1 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PCMT1 Antibody

Western Blot: PCMT1 Antibody [NBP3-38309] -

Western Blot: PCMT1 Antibody [NBP3-38309] - Western blot analysis of various lysates using PCMT1 Rabbit pAb.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
PCMT1 Antibody

Immunoprecipitation: PCMT1 Antibody [NBP3-38309] -

Immunoprecipitation: PCMT1 Antibody [NBP3-38309] - Immunoprecipitation analysis of 200 ug extracts of HepG2 cells using PCMT1 antibody. Western blot was performed from the immunoprecipitate using PCMT1 antibody at a dilution of 1:1000.

Applications for PCMT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PCMT1

Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.[supplied by OMIM]

Alternate Names

EC 2.1.1, EC 2.1.1.77, L-isoaspartyl protein carboxyl methyltransferase, L-isoaspartyl/D-aspartyl methyltransferase, PIMT, Protein L-isoaspartyl/D-aspartyl methyltransferase, Protein-beta-aspartate methyltransferase, protein-L-isoaspartate (D-aspartate) O-methyltransferase, protein-L-isoaspartate(D-aspartate) O-methyltransferase

Gene Symbol

PCMT1

Additional PCMT1 Products

Product Documents for PCMT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCMT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCMT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCMT1 Antibody - BSA Free and earn rewards!

Have you used PCMT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...