PDE6D Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86275

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (99%), Rat (97%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PDE6D Antibody - BSA Free

Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275]

Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275]

Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275]

Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275]

Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275]

Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275]

Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275]

Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275]

Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and no positivity in cells in glomeruli as expected.

Applications for PDE6D Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDE6D

PDE6D is the effector enzyme in the G protein-mediated signal transduction cascade in the visual system. The second messengers cAMP and cGMP are key regulatory molecules that are involved in a wide variety of signal transduction pathways, such as insulin secretion, platelet aggregation, smooth muscle relaxation, olfaction, and vision. Levels of cAMP and cGMP are regulated by their rate of synthesis by nucleotide cyclases and by their rate of hydrolysis by cyclic nucleotide phosphodiesterases (PDEs). PDEs form a superfamily of enzymes that catalyze the conversion of 3-prime, 5-prime-cyclic nucleotides to the corresponding nucleoside 5-prime-monophosphates. While mammalian PDEs are divided into major families based on their substrate specificities, kinetic properties, allosteric regulators, inhibitor sensitivities, and amino acid sequences, each family and even members within a family display distinct tissue, cell, and subcellular expression patters. This suggests that individual PDE family members are involved in discrete signal transduction pathways. There are five different subunits consisting of rod and cone specific catalytic subunits: alpha® (Cone), alpha (Rod), and beta (Rod), the inhibitory subunit gamma, and subunit delta of unknown function (which likely interacts with many other proteins besides the PDE6 family). The catalytic core of the PDE6 system is comprised of alpha®/alpha® homodimers in the cone and alpha/beta heterodimers in the rod. The C-terminus of both the catalytic and inhibitory subunits is modified by methylation, myristyolation and prenylation which have been shown to be critical for proper complex assembly and membrane association.

Long Name

Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

Alternate Names

GMP-PDE delta, PDED, Protein p17

Gene Symbol

PDE6D

Additional PDE6D Products

Product Documents for PDE6D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PDE6D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PDE6D Antibody - BSA Free

Customer Reviews for PDE6D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDE6D Antibody - BSA Free and earn rewards!

Have you used PDE6D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...