PDGFA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82303

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PDGF-A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDGFA. Peptide sequence: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PDGFA Antibody - BSA Free

Western Blot: PDGFA Antibody [NBP2-82303]

Western Blot: PDGFA Antibody [NBP2-82303]

Western Blot: PDGFA Antibody [NBP2-82303] - Host: Rabbit. Target Name: PDGFA. Sample Type: U937 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for PDGFA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDGF-A

Platelet-Derived Growth Factor (PDGF) is the major serum mitogen for cells of mesenchymal origin in humans. The biologically active protein is a dimer composed of two related polypeptides designated A and B. The PDGF protein has been implicated both directly as well as indirectly in several pathological states including neoplasia, arthritis, arteriosclerosis and bone marrow sclerosis. This antibody is specific for B form and reacts with PDGF(AB) and PDGF(BB) protein.

Long Name

Platelet-derived Growth Factor A

Alternate Names

PDGF-1, PDGF1PDGF A-chain, PDGF-A, Platelet-derived growth factor A chain, platelet-derived growth factor alpha chain, platelet-derived growth factor alpha isoform 2 preproprotein, platelet-derived growth factor alpha polypeptidePDGF subunit A, platelet-derived growth factor subunit A

Gene Symbol

PDGFA

Additional PDGF-A Products

Product Documents for PDGFA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PDGFA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

PDGF Family

Customer Reviews for PDGFA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDGFA Antibody - BSA Free and earn rewards!

Have you used PDGFA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies