PDGFA Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05169

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all PDGF-A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 21-110 of human PDGFA (NP_002598.4). EEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHATKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PDGFA Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: PDGFA Antibody - Azide and BSA Free [NBP3-05169]

Immunohistochemistry-Paraffin: PDGFA Antibody - Azide and BSA Free [NBP3-05169]

Immunohistochemistry-Paraffin: PDGFA Antibody [NBP3-05169] - Immunohistochemistry of paraffin-embedded Human esophagus using PDGFA antibody (NBP3-05169) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for PDGFA Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PDGF-A

Platelet-Derived Growth Factor (PDGF) is the major serum mitogen for cells of mesenchymal origin in humans. The biologically active protein is a dimer composed of two related polypeptides designated A and B. The PDGF protein has been implicated both directly as well as indirectly in several pathological states including neoplasia, arthritis, arteriosclerosis and bone marrow sclerosis. This antibody is specific for B form and reacts with PDGF(AB) and PDGF(BB) protein.

Long Name

Platelet-derived Growth Factor A

Alternate Names

PDGF-1, PDGF1PDGF A-chain, PDGF-A, Platelet-derived growth factor A chain, platelet-derived growth factor alpha chain, platelet-derived growth factor alpha isoform 2 preproprotein, platelet-derived growth factor alpha polypeptidePDGF subunit A, platelet-derived growth factor subunit A

Gene Symbol

PDGFA

Additional PDGF-A Products

Product Documents for PDGFA Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PDGFA Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

PDGF Family

Customer Reviews for PDGFA Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PDGFA Antibody - Azide and BSA Free and earn rewards!

Have you used PDGFA Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies