PDK4 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-49235PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDK4.

Source: E. coli

Amino Acid Sequence: QSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49235.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-49235PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PDK4

Pyruvate dehydrogenase kinase isoform 4 (PDK4) is a component of the mitochondrial multienzyme complex (PHD) which is responsible for carbohydrate fuel regulation. PDK1 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

PDK4 antibodies are useful tools for glucose metabolism research and mitochondiral metabolism studies.

Alternate Names

[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial, EC 2.7.11, EC 2.7.11.2, FLJ40832, Pyruvate dehydrogenase kinase isoform 4, pyruvate dehydrogenase kinase, isoenzyme 4, pyruvate dehydrogenase kinase, isozyme 4, pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial

Gene Symbol

PDK4

Additional PDK4 Products

Product Documents for PDK4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PDK4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PDK4 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PDK4 Recombinant Protein Antigen and earn rewards!

Have you used PDK4 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for PDK4 Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Which PDK4 antibody do you recommend for immunoblot? I'm working with human cell lines.

    A:

    NBP1-07047 and NBP1-07049 are our best selling PDK4 antibodies that will meet your mentioned criteria i.e. Immunoblot/Western Blot in Human samples. However, all of our products are 100% guaranteed and you may find a complete list of PDK4 antibodies by searching PDK4 on our website and narrowing your results using the filters on the left-hand side of the screen.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...